Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ω-agatoxin-IVA

Product Specifications

CAS Number

145017-83-0

Synonyms

H-KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp148 Peptide - N-terminal region
MBS3229646-01 0.1 mg

Zfp148 Peptide - N-terminal region

Sign In for Pricing
View Details
Zfp148 Peptide - N-terminal region
MBS3229646-02 5x 0.1 mg

Zfp148 Peptide - N-terminal region

Sign In for Pricing
View Details
C5orf63 Human siRNA Oligo Duplex (Locus ID 401207)
SR318354 1 Kit

C5orf63 Human siRNA Oligo Duplex (Locus ID 401207)

Sign In for Pricing
View Details
CHCHD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV708693 1.0 µg DNA

CHCHD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TMEM126B siRNA (Human)
orb1857278-01 15 nmol

TMEM126B siRNA (Human)

Sign In for Pricing
View Details
TMEM126B siRNA (Human)
orb1857278-02 30 nmol

TMEM126B siRNA (Human)

Sign In for Pricing
View Details