Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ρ-Da1a (AdTx1)

Product Specifications

Synonyms

H-LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spiramycin (SPY) ELISA Kit

abx365128 96 Tests

Spiramycin (SPY) ELISA Kit

Sign In for Pricing

Wdr27 Mouse Gene Knockout Kit (CRISPR)

KN519348 1 Kit

Wdr27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing

LYN (NM_001111097) Human Recombinant Protein

PROTP07948 20 µg

LYN (NM_001111097) Human Recombinant Protein

Sign In for Pricing

CECR6 Adenovirus (Human)

15844051 1.0 mL

CECR6 Adenovirus (Human)

Sign In for Pricing

anti-NEDD8 (1A7)

LF-MA30675 100 ul

anti-NEDD8 (1A7)

Sign In for Pricing

Peroxidase Anti-Peroxidase (PAP) Soluble Immune Complex

MBS653771-01 0.25 mL

Peroxidase Anti-Peroxidase (PAP) Soluble Immune Complex

Sign In for Pricing