Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OD1

Product Specifications

Synonyms

H-GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copper (I) Chloride Anhydrous 97% Extrapure
86101000 1 Kg

Copper (I) Chloride Anhydrous 97% Extrapure

Sign In for Pricing
View Details
Ac4ManNAz
CLK-1084-25 5x 5 mg

Ac4ManNAz

Sign In for Pricing
View Details
PRKCBP1 Rabbit Polyclonal Antibody (AP)
orb958078 100 µL

PRKCBP1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
TRP12/TRPV4 Rabbit Polyclonal Antibody (BF350)
orb1579233 100 µL

TRP12/TRPV4 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
GEFT Rabbit Polyclonal Antibody
orb582074 100 µL

GEFT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HAUS3, ID (HAUS3, C4orf15, HAUS augmin-like complex subunit 3) (PE)
MBS6305492-01 0.2 mL

HAUS3, ID (HAUS3, C4orf15, HAUS augmin-like complex subunit 3) (PE)

Sign In for Pricing
View Details