Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OD1

Product Specifications

Synonyms

H-GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUP1 Rabbit Polyclonal Antibody (Cy5)
orb957684 100 µL

MUP1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
GABA A Receptor alpha 2, Control Peptide (GAA2)
G1015-07F 100 µg

GABA A Receptor alpha 2, Control Peptide (GAA2)

Sign In for Pricing
View Details
Human Urotensin-2B ELISA Kit
orb1659860 96 Tests

Human Urotensin-2B ELISA Kit

Sign In for Pricing
View Details
MEGF10 Protein Vector (Human) (pPM-C-HA)
PV093764 500 ng

MEGF10 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
GTF2H4 Rabbit Polyclonal Antibody (RBITC)
orb1067206 100 µL

GTF2H4 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
KRT18 (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (MaxLight 490)
128937-ML490 100 µL

KRT18 (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (MaxLight 490)

Sign In for Pricing
View Details