Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Obtustatin

Product Specifications

Synonyms

H-CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYCE1 Rabbit Polyclonal Antibody

TA382227 100 µL

SYCE1 Rabbit Polyclonal Antibody

Sign In for Pricing

Tert-Butyl 1-aminocyclohexane-1-carboxylate hydrochloride

NKD27893-01 50 mg

Tert-Butyl 1-aminocyclohexane-1-carboxylate hydrochloride

Sign In for Pricing

Tert-Butyl 1-aminocyclohexane-1-carboxylate hydrochloride

NKD27893-02 0.5 g

Tert-Butyl 1-aminocyclohexane-1-carboxylate hydrochloride

Sign In for Pricing

Anti-NS5b (HCV)

IT-004-013M6-01 0.1 mg

Anti-NS5b (HCV)

Sign In for Pricing

Anti-NS5b (HCV)

IT-004-013M6-02 0.5 mg

Anti-NS5b (HCV)

Sign In for Pricing

Anti-NS5b (HCV)

IT-004-013M6-03 1 mg

Anti-NS5b (HCV)

Sign In for Pricing