Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Obtustatin

Product Specifications

Synonyms

H-CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nos1ap ELISA Kit

ELI-10812m 96 Tests

Mouse Nos1ap ELISA Kit

Sign In for Pricing

TWF2 Antibody

15-123 100 µL

TWF2 Antibody

Sign In for Pricing

Transthyretin (Wild Type) Human, Recombinant

orb1401969 1 mg

Transthyretin (Wild Type) Human, Recombinant

Sign In for Pricing

SEPTIN1 Human qPCR Template Standard (NM_052838)

HK211500 1 Kit

SEPTIN1 Human qPCR Template Standard (NM_052838)

Sign In for Pricing

Rabbit Anti-Human IgG F (ab') 2 Antibody (AF790)

abx142694-01 100 µL

Rabbit Anti-Human IgG F (ab') 2 Antibody (AF790)

Sign In for Pricing

Rabbit Anti-Human IgG F (ab') 2 Antibody (AF790)

abx142694-02 500 µL

Rabbit Anti-Human IgG F (ab') 2 Antibody (AF790)

Sign In for Pricing