Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MT7 – Muscarinic Toxin 7

Product Specifications

Synonyms

H-LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK-OH

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH-CMV-FGGEF1A-EGFP-T2A-PURO
BZ0787-4 1 Vial

PCDH-CMV-FGGEF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details
Olr1475 Protein Vector (Rat) (pPB-N-His)
PV288299 500 ng

Olr1475 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Human PTP4A2 Protein
orb427973-01 2 µg

Human PTP4A2 Protein

Sign In for Pricing
View Details
Human PTP4A2 Protein
orb427973-02 10 µg

Human PTP4A2 Protein

Sign In for Pricing
View Details
Human PTP4A2 Protein
orb427973-03 1 mg

Human PTP4A2 Protein

Sign In for Pricing
View Details
Rat Pulmonary Surfactant-Associated Protein C (SFTPC) CLIA Kit
abx492918-01 96 Tests

Rat Pulmonary Surfactant-Associated Protein C (SFTPC) CLIA Kit

Sign In for Pricing
View Details