Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MT7 – Muscarinic Toxin 7

Product Specifications

Synonyms

H-LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK-OH

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neopterin ELISA Kit
orb564349-01 48 Tests

Human Neopterin ELISA Kit

Sign In for Pricing
View Details
Human Neopterin ELISA Kit
orb564349-02 96 Tests

Human Neopterin ELISA Kit

Sign In for Pricing
View Details
Campylobacter Antimicrobic Supplement, Blaser discontinued
C1038-01-01 5x 5 mL

Campylobacter Antimicrobic Supplement, Blaser discontinued

Sign In for Pricing
View Details
Campylobacter Antimicrobic Supplement, Blaser discontinued
C1038-01-02 10x 5 mL

Campylobacter Antimicrobic Supplement, Blaser discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal MARCKS Antibody
NBP2-58267-25ul 25 µL

Rabbit Polyclonal MARCKS Antibody

Sign In for Pricing
View Details
3'-O-propargyl A 2'-5' linked 1 umol scale
27-6919A-01 1 Each

3'-O-propargyl A 2'-5' linked 1 umol scale

Sign In for Pricing
View Details