Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Latartoxin-1a

Product Specifications

Synonyms

H-ECIPTKHDCTNDRKNCCPGHECKCYNTQIGGSKKEQCGCKKSLLAKAKNFGGKVITIFKA-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNGTT polyclonal antibody
BS8211-01 50 µL

RNGTT polyclonal antibody

Sign In for Pricing
View Details
RNGTT polyclonal antibody
BS8211-02 100 µL

RNGTT polyclonal antibody

Sign In for Pricing
View Details
InVivo Plus Mouse IgG2b, kappa Isotype Control Antibody (SAA0542)
MF974019-01 1 mg

InVivo Plus Mouse IgG2b, kappa Isotype Control Antibody (SAA0542)

Sign In for Pricing
View Details
InVivo Plus Mouse IgG2b, kappa Isotype Control Antibody (SAA0542)
MF974019-02 5 mg

InVivo Plus Mouse IgG2b, kappa Isotype Control Antibody (SAA0542)

Sign In for Pricing
View Details
InVivo Plus Mouse IgG2b, kappa Isotype Control Antibody (SAA0542)
MF974019-03 25 mg

InVivo Plus Mouse IgG2b, kappa Isotype Control Antibody (SAA0542)

Sign In for Pricing
View Details
InVivo Plus Mouse IgG2b, kappa Isotype Control Antibody (SAA0542)
MF974019-04 50 mg

InVivo Plus Mouse IgG2b, kappa Isotype Control Antibody (SAA0542)

Sign In for Pricing
View Details