Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Latartoxin-1a

Product Specifications

Synonyms

H-ECIPTKHDCTNDRKNCCPGHECKCYNTQIGGSKKEQCGCKKSLLAKAKNFGGKVITIFKA-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNLT1 Rabbit Polyclonal Antibody
orb2950785-01 50 µg

DYNLT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DYNLT1 Rabbit Polyclonal Antibody
orb2950785-02 100 µg

DYNLT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
[KO Validated] Acetyl-H mgB1-K29 Rabbit pAb
E45R30320N-50 50 µL

[KO Validated] Acetyl-H mgB1-K29 Rabbit pAb

Sign In for Pricing
View Details
Phospho-Bcl2 (Thr69) Polyclonal Antibody, HRP Conjugated
bs-12578R-HRP 100 µL

Phospho-Bcl2 (Thr69) Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
MANF Polyclonal Antibody
A73646-050 50 µL

MANF Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1)
SIPH667Mu02-01 10 µg

Recombinant Serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1)

Sign In for Pricing
View Details