Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hainantoxin-IV

Product Specifications

Synonyms

H-ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salt Polymixin Broth Base
RDM-SPB-01 500 g

Salt Polymixin Broth Base

Sign In for Pricing
View Details
Anti-SUR1 Antibody FL490 Conjugate
75-267-FL490 200 µL

Anti-SUR1 Antibody FL490 Conjugate

Sign In for Pricing
View Details
MIP-1alpha Antibody
MBS9508930-01 0.05 mL

MIP-1alpha Antibody

Sign In for Pricing
View Details
MIP-1alpha Antibody
MBS9508930-02 0.1 mL

MIP-1alpha Antibody

Sign In for Pricing
View Details
MIP-1alpha Antibody
MBS9508930-03 5x 0.1 mL

MIP-1alpha Antibody

Sign In for Pricing
View Details
Anti-Human CENPC Antibody (SAA2160)
RHF98601 100 μg

Anti-Human CENPC Antibody (SAA2160)

Sign In for Pricing
View Details