Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Echistatin α1 isoform

Product Specifications

CAS Number

154303-05-6

Synonyms

H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT-OH

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADP-Ribosylation Factor 1 Human Recombinant (ARF1 Human)
PT_39942-01 5 µg

ADP-Ribosylation Factor 1 Human Recombinant (ARF1 Human)

Sign In for Pricing
View Details
ADP-Ribosylation Factor 1 Human Recombinant (ARF1 Human)
PT_39942-02 20 µg

ADP-Ribosylation Factor 1 Human Recombinant (ARF1 Human)

Sign In for Pricing
View Details
ADP-Ribosylation Factor 1 Human Recombinant (ARF1 Human)
PT_39942-03 1 mg

ADP-Ribosylation Factor 1 Human Recombinant (ARF1 Human)

Sign In for Pricing
View Details
RHCG Antibody
DF10084-01 100 µL

RHCG Antibody

Sign In for Pricing
View Details
RHCG Antibody
DF10084-02 200 µL

RHCG Antibody

Sign In for Pricing
View Details
Cytarabine hydrochloride - Bio-X TM
BA164338 100 mg

Cytarabine hydrochloride - Bio-X TM

Sign In for Pricing
View Details