Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Echistatin α1 isoform

Product Specifications

CAS Number

154303-05-6

Synonyms

H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT-OH

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tetanus Toxiod PAb, HRP-conjugated Antibody
orb593648-01 100 µL

Rat Tetanus Toxiod PAb, HRP-conjugated Antibody

Sign In for Pricing
View Details
Rat Tetanus Toxiod PAb, HRP-conjugated Antibody
orb593648-02 500 μL

Rat Tetanus Toxiod PAb, HRP-conjugated Antibody

Sign In for Pricing
View Details
Recombinant Rat Probable G-protein coupled receptor 157 (Gpr157)
orb2905871-01 20 µg

Recombinant Rat Probable G-protein coupled receptor 157 (Gpr157)

Sign In for Pricing
View Details
Recombinant Rat Probable G-protein coupled receptor 157 (Gpr157)
orb2905871-02 100 µg

Recombinant Rat Probable G-protein coupled receptor 157 (Gpr157)

Sign In for Pricing
View Details
Anti-RHBG Antibody Picoband®, Dylight550 Conjugate
A05585-1-Dylight550 100 µg

Anti-RHBG Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Anti-CD179b Antibody
MBS9239894-01 0.05 mL

Anti-CD179b Antibody

Sign In for Pricing
View Details