Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDS-I

Product Specifications

Synonyms

H-AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spinlw1 3'UTR GFP Stable Cell Line
TU271097 1.0 mL

Spinlw1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TMEM173 antibody
70R-2359 100 µL

TMEM173 antibody

Sign In for Pricing
View Details
Alpha-actinin-1 Rabbit pAb
orb2837309-01 50 µL

Alpha-actinin-1 Rabbit pAb

Sign In for Pricing
View Details
Alpha-actinin-1 Rabbit pAb
orb2837309-02 100 µL

Alpha-actinin-1 Rabbit pAb

Sign In for Pricing
View Details
Alpha-actinin-1 Rabbit pAb
orb2837309-03 200 µL

Alpha-actinin-1 Rabbit pAb

Sign In for Pricing
View Details
PHD Finger Protein 21A (PHF21A) Antibody
abx028858-01 80 µL

PHD Finger Protein 21A (PHF21A) Antibody

Sign In for Pricing
View Details