Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDS-I

Product Specifications

Synonyms

H-AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Phosphate carrier protein, mitochondrial (Slc25a3), partial
MBS7112358 Inquire

Recombinant Rat Phosphate carrier protein, mitochondrial (Slc25a3), partial

Sign In for Pricing
View Details
MAN2A1 (MANA2, Alpha-mannosidase 2, Golgi alpha-mannosidase II, Mannosidase alpha Class 2A Member 1, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (MaxLight 750) discontinued
129343-ML750 100 µL

MAN2A1 (MANA2, Alpha-mannosidase 2, Golgi alpha-mannosidase II, Mannosidase alpha Class 2A Member 1, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant human IFN-omega protein
ATGP4133-100 100 µg

Recombinant human IFN-omega protein

Sign In for Pricing
View Details
Anti-5HT1B/HTR1B Antibody Picoband®, PE Conjugate
A01826-2-PE 100 µg/Vial

Anti-5HT1B/HTR1B Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Human Lck Alexa Fluor 594 Antibody (Clone 693010)
IC37041T-100UG 100 µg

Human Lck Alexa Fluor 594 Antibody (Clone 693010)

Sign In for Pricing
View Details
Phospho-MSK1 (Ser376) Rabbit Monoclonal Antibody
AF2200 50 µL

Phospho-MSK1 (Ser376) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details