Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATX-II

Product Specifications

CAS Number

60748-45-0

Synonyms

H-GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Uncoupling Protein 1, Mitochondrial ELISA Kit
MBS058911-01 48 Well

Mouse Uncoupling Protein 1, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Uncoupling Protein 1, Mitochondrial ELISA Kit
MBS058911-02 96 Well

Mouse Uncoupling Protein 1, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Uncoupling Protein 1, Mitochondrial ELISA Kit
MBS058911-03 5x 96 Well

Mouse Uncoupling Protein 1, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Uncoupling Protein 1, Mitochondrial ELISA Kit
MBS058911-04 10x 96 Well

Mouse Uncoupling Protein 1, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
EMX1 Antibody
47106 100 µL

EMX1 Antibody

Sign In for Pricing
View Details
1- (4-Bromophenyl) -2,2,2-trifluoroethanamine
TIB60846-01 250 mg

1- (4-Bromophenyl) -2,2,2-trifluoroethanamine

Sign In for Pricing
View Details