Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATX-II

Product Specifications

CAS Number

60748-45-0

Synonyms

H-GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MutY Homolog (MUTYH) CLIA Kit

abx495775-01 96 Tests

Human MutY Homolog (MUTYH) CLIA Kit

Sign In for Pricing

Human MutY Homolog (MUTYH) CLIA Kit

abx495775-02 5x 96 Tests

Human MutY Homolog (MUTYH) CLIA Kit

Sign In for Pricing

Human MutY Homolog (MUTYH) CLIA Kit

abx495775-03 10x 96 Tests

Human MutY Homolog (MUTYH) CLIA Kit

Sign In for Pricing

Secretogranin II Protein, Human, Recombinant (His Tag)

MBS8121411-01 0.1 mg

Secretogranin II Protein, Human, Recombinant (His Tag)

Sign In for Pricing

Secretogranin II Protein, Human, Recombinant (His Tag)

MBS8121411-02 5x 0.1 mg

Secretogranin II Protein, Human, Recombinant (His Tag)

Sign In for Pricing

TRNAP8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

K2510805 3x 1.0 µg

TRNAP8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing