Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AmmTx3

Product Specifications

Synonyms

PQ-IETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP-OH

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella loihica Lipoprotein signal peptidase (lspA)
MBS1024358 Inquire

Recombinant Shewanella loihica Lipoprotein signal peptidase (lspA)

Sign In for Pricing
View Details
RPL28 Protein Vector (Mouse) (pPB-N-His)
PV225363 500 ng

RPL28 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
SERPINB13 Rabbit pAb
MBS8549205-01 0.1 mL

SERPINB13 Rabbit pAb

Sign In for Pricing
View Details
SERPINB13 Rabbit pAb
MBS8549205-02 0.1 mL (AF405L)

SERPINB13 Rabbit pAb

Sign In for Pricing
View Details
SERPINB13 Rabbit pAb
MBS8549205-03 0.1 mL (AF405S)

SERPINB13 Rabbit pAb

Sign In for Pricing
View Details
SERPINB13 Rabbit pAb
MBS8549205-04 0.1 mL (AF610)

SERPINB13 Rabbit pAb

Sign In for Pricing
View Details