Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aah-II

Product Specifications

Synonyms

H-VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH-NH2

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRH1 Protein Vector (Human) (pPB-N-His)
PV056638 500 ng

PRH1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PDXK, NT (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (Azide free) (HRP)
MBS6492561-01 0.2 mL

PDXK, NT (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (Azide free) (HRP)

Sign In for Pricing
View Details
PDXK, NT (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (Azide free) (HRP)
MBS6492561-02 5x 0.2 mL

PDXK, NT (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (Azide free) (HRP)

Sign In for Pricing
View Details
Myosin-11 (MYH11) Porcine ELISA Kit
F1956 96 Tests

Myosin-11 (MYH11) Porcine ELISA Kit

Sign In for Pricing
View Details
(N-Dansyl) biocytinamidoethyl methanethiosulphonate [MTS-DB]
OR7702T 1 Each

(N-Dansyl) biocytinamidoethyl methanethiosulphonate [MTS-DB]

Sign In for Pricing
View Details
ANAPC2 discontinued
385794 200 µL

ANAPC2 discontinued

Sign In for Pricing
View Details