Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Beta-Defensin 3 peptide

Product Specifications

Synonyms

H-KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK-OH

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pK19mobsacB Plasmid
PVT10633 2 µg

pK19mobsacB Plasmid

Sign In for Pricing
View Details
Eco Alu MTP (HxD) 7x6=42 plates 35mm, 260x540x135mm
TE15326 1 Piece

Eco Alu MTP (HxD) 7x6=42 plates 35mm, 260x540x135mm

Sign In for Pricing
View Details
PROCA1 Rabbit Polyclonal Antibody
orb581908 100 µL

PROCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTC6, CT (TTC6, Tetratricopeptide repeat protein 6) (MaxLight 550)
MBS6359965-01 0.1 mL

TTC6, CT (TTC6, Tetratricopeptide repeat protein 6) (MaxLight 550)

Sign In for Pricing
View Details
TTC6, CT (TTC6, Tetratricopeptide repeat protein 6) (MaxLight 550)
MBS6359965-02 5x 0.1 mL

TTC6, CT (TTC6, Tetratricopeptide repeat protein 6) (MaxLight 550)

Sign In for Pricing
View Details
Ezrin (Ab-146) Antibody
E11-8030B 100 µg

Ezrin (Ab-146) Antibody

Sign In for Pricing
View Details