Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Beta-Defensin 3 peptide

Product Specifications

Synonyms

H-KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK-OH

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PRKDC Ser3191) Antibody Blocking Peptide
orb1515467 500 µg

Phospho-PRKDC Ser3191) Antibody Blocking Peptide

Sign In for Pricing
View Details
Hepatitis B Surface Antigen / HBsAg mouse monoclonal antibody, clone HB5
3HB12-HB5 1 mg

Hepatitis B Surface Antigen / HBsAg mouse monoclonal antibody, clone HB5

Sign In for Pricing
View Details
Dog Albumin (ALB) ELISA Kit
orb775216-01 48 Tests

Dog Albumin (ALB) ELISA Kit

Sign In for Pricing
View Details
Dog Albumin (ALB) ELISA Kit
orb775216-02 96 Tests

Dog Albumin (ALB) ELISA Kit

Sign In for Pricing
View Details
GABA-RB Antibody (Phospho-Ser434) : Biotin (OAAF07318-Biotin)
OAAF07318-100UG-Biotin 100 µg

GABA-RB Antibody (Phospho-Ser434) : Biotin (OAAF07318-Biotin)

Sign In for Pricing
View Details
Interleukin 1 Receptor Associated Kinase 4 (IRAK4) Antibody
abx431846 200 µL

Interleukin 1 Receptor Associated Kinase 4 (IRAK4) Antibody

Sign In for Pricing
View Details