What is the catalog number for Human beta-defensin-2 peptide?

The catalog number for Human beta-defensin-2 peptide is PP51063.

What sizes are available for Human beta-defensin-2 peptide?

Human beta-defensin-2 peptide is available in the following size(s): 0.1 mg.

Human beta-defensin-2 peptide is currently made to order / not held in immediate stock. Contact us for lead time.

H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH

No

More Discoveries

Browse additional items from our catalog

mr0774 250 µL

Sign In for Pricing

28178161 1.0 µg

Sign In for Pricing

MBS1750814-01 0.01 mg

Sign In for Pricing

MBS1750814-02 0.1 mg (Carrier Free)

Sign In for Pricing

MBS1750814-03 0.1 mg

Sign In for Pricing

MBS1750814-04 0.1 mg (Cy3)

Sign In for Pricing