Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human beta-defensin-2 peptide

Product Specifications

Synonyms

H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamate Receptor Ionotropic, NMDA 1 (GRIN1) Antibody (ATTO390)
abx440170 100 µg

Glutamate Receptor Ionotropic, NMDA 1 (GRIN1) Antibody (ATTO390)

Sign In for Pricing
View Details
ASXL2 CRISPR/Cas9 KO Plasmid (m)
sc-429050 20 µg

ASXL2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human β-Defensin 4A/DEFB4A Protein
PKSH033266-01 10 µg

Recombinant Human β-Defensin 4A/DEFB4A Protein

Sign In for Pricing
View Details
Recombinant Human β-Defensin 4A/DEFB4A Protein
PKSH033266-02 50 µg

Recombinant Human β-Defensin 4A/DEFB4A Protein

Sign In for Pricing
View Details
Recombinant Brucella ovis Putative peptide permease protein BOV_A0350 (BOV_A0350)
MBS7036896-01 0.02 mg

Recombinant Brucella ovis Putative peptide permease protein BOV_A0350 (BOV_A0350)

Sign In for Pricing
View Details
Recombinant Brucella ovis Putative peptide permease protein BOV_A0350 (BOV_A0350)
MBS7036896-02 0.1 mg

Recombinant Brucella ovis Putative peptide permease protein BOV_A0350 (BOV_A0350)

Sign In for Pricing
View Details