Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEP (1-40)

Product Specifications

CAS Number

475221-20-6

Synonyms

H-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2; NH2-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg- Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu- Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-amide

Molecular Formula

C206H324N56O65

Molecular Weight

4,583.08 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xenopus laevis WD repeat-containing and planar cell polarity effector protein fritz homolog (wdpcp), partial
MBS1445198 Inquire

Recombinant Xenopus laevis WD repeat-containing and planar cell polarity effector protein fritz homolog (wdpcp), partial

Sign In for Pricing
View Details
Human Leukocyte surface antigen CD47, CD47 ELISA KIT
ELI-24933h 96 Tests

Human Leukocyte surface antigen CD47, CD47 ELISA KIT

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Glucosamine-6-phosphate deaminase 1 (nagB)
MBS1235944-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Glucosamine-6-phosphate deaminase 1 (nagB)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Glucosamine-6-phosphate deaminase 1 (nagB)
MBS1235944-02 0.1 mg (E-Coli)

Recombinant Bacillus subtilis Glucosamine-6-phosphate deaminase 1 (nagB)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Glucosamine-6-phosphate deaminase 1 (nagB)
MBS1235944-03 0.02 mg (Yeast)

Recombinant Bacillus subtilis Glucosamine-6-phosphate deaminase 1 (nagB)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Glucosamine-6-phosphate deaminase 1 (nagB)
MBS1235944-04 0.1 mg (Yeast)

Recombinant Bacillus subtilis Glucosamine-6-phosphate deaminase 1 (nagB)

Sign In for Pricing
View Details