Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEP (1-40)

Product Specifications

CAS Number

475221-20-6

Synonyms

H-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2; NH2-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg- Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu- Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-amide

Molecular Formula

C206H324N56O65

Molecular Weight

4,583.08 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transgelin-2
AP88817 1 mg

Transgelin-2

Sign In for Pricing
View Details
Human FLT4/VEGFR3 ELISA Kit PicoKine®, Carrier-free
EK0545-carrier-free 96 Well With Removable Strips

Human FLT4/VEGFR3 ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
Rabbit anti-RUFY1 Antibody
MBS4510445-01 0.05 mL

Rabbit anti-RUFY1 Antibody

Sign In for Pricing
View Details
Rabbit anti-RUFY1 Antibody
MBS4510445-02 0.1 mL

Rabbit anti-RUFY1 Antibody

Sign In for Pricing
View Details
Rabbit anti-RUFY1 Antibody
MBS4510445-03 5x 0.1 mL

Rabbit anti-RUFY1 Antibody

Sign In for Pricing
View Details
Genesig Real-Time PCR Detection Kit for Alpha Toxin Producing Clostridium perfringens, Advanced
348876 1 Kit

Genesig Real-Time PCR Detection Kit for Alpha Toxin Producing Clostridium perfringens, Advanced

Sign In for Pricing
View Details