Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-39)

Product Specifications

CAS Number

115427-62-8

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Va l-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-OH; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH

Molecular Formula

C203H311N55O60S

Molecular Weight

4,514.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OBFC1, CT (OBFC1, STN1, CST complex subunit STN1, Oligonucleotide/oligosaccharide-binding fold-containing protein 1, Suppressor of cdc thirteen homolog) (APC) discontinued
039245-APC 200 µL

OBFC1, CT (OBFC1, STN1, CST complex subunit STN1, Oligonucleotide/oligosaccharide-binding fold-containing protein 1, Suppressor of cdc thirteen homolog) (APC) discontinued

Sign In for Pricing
View Details
Anti-Collagen I/COL1A1 Antibody Picoband®
PA2140-1 100 µg/Vial

Anti-Collagen I/COL1A1 Antibody Picoband®

Sign In for Pricing
View Details
Rno-miR-10b-5p miRNA Antagomir
orb1911765-01 10 nmol

Rno-miR-10b-5p miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-10b-5p miRNA Antagomir
orb1911765-02 20 nmol

Rno-miR-10b-5p miRNA Antagomir

Sign In for Pricing
View Details
Sterol O-acyltransferase 2 Recombinant Protein
92-209 0.05 mg

Sterol O-acyltransferase 2 Recombinant Protein

Sign In for Pricing
View Details
ZFP319 (h) -PR
sc-93080-PR 10 µM - 20 µL

ZFP319 (h) -PR

Sign In for Pricing
View Details