Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-39)

Product Specifications

CAS Number

115427-62-8

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Va l-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-OH; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH

Molecular Formula

C203H311N55O60S

Molecular Weight

4,514.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGLN3 Knockout Cell Line-HEK293
RK-0969 1x 10^6

EGLN3 Knockout Cell Line-HEK293

Sign In for Pricing
View Details
ACP1 CRISPR/Cas9 KO Plasmid (m)
sc-418949 20 µg

ACP1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal AKR1B1 Antibody [Allophycocyanin]
NBP2-99771APC 0.1 mL

Rabbit Polyclonal AKR1B1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
NUMBL Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-11974R-APC-Cy5.5 100 µL

NUMBL Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Syndecan-1/CD138 Antibody (DL-101) [Janelia Fluor 669]
NBP1-43351JF669 0.1 mL

Mouse Monoclonal Syndecan-1/CD138 Antibody (DL-101) [Janelia Fluor 669]

Sign In for Pricing
View Details
Tert-Butyl N- (4-iodo-2-methoxyphenyl) carbamate
BKB34694-01 100 mg

Tert-Butyl N- (4-iodo-2-methoxyphenyl) carbamate

Sign In for Pricing
View Details