Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-39)

Product Specifications

CAS Number

115427-62-8

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Va l-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-OH; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH

Molecular Formula

C203H311N55O60S

Molecular Weight

4,514.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ONO 2506
B7676-5 5 mg

ONO 2506

Sign In for Pricing
View Details
Histone H3 Polyclonal Antibody
MBS9246050-01 0.1 mL

Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 Polyclonal Antibody
MBS9246050-02 5x 0.1 mL

Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
Histone H1
1107NF-v7013 0.5/ml

Histone H1

Sign In for Pricing
View Details
Hyaluronic Acid (HA) BioAssayTM ELISA Kit (Universal)
356183-01 48 Tests

Hyaluronic Acid (HA) BioAssayTM ELISA Kit (Universal)

Sign In for Pricing
View Details
Hyaluronic Acid (HA) BioAssayTM ELISA Kit (Universal)
356183-02 96 Tests

Hyaluronic Acid (HA) BioAssayTM ELISA Kit (Universal)

Sign In for Pricing
View Details