Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-39)

Product Specifications

CAS Number

115427-62-8

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Va l-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-OH; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH

Molecular Formula

C203H311N55O60S

Molecular Weight

4,514.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF3 (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (Azide free) (HRP) discontinued
031327-HRP 100 µL

VEGF3 (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
MACSL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
61508111 3x 1.0 µg

MACSL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Anti-Human CHSY1 Polyclonal Antibody
PA85828HU-01 50 µg

Rabbit Anti-Human CHSY1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CHSY1 Polyclonal Antibody
PA85828HU-02 100 µg

Rabbit Anti-Human CHSY1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CHSY1 Polyclonal Antibody
PA85828HU-03 500 µg

Rabbit Anti-Human CHSY1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CHSY1 Polyclonal Antibody
PA85828HU-04 1 mg

Rabbit Anti-Human CHSY1 Polyclonal Antibody

Sign In for Pricing
View Details