Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thioredoxin (TXN)

Product Specifications

Product Name Alternative

ATL-derived factor ; ADFSurface-associated sulphydryl protein ; SASP

Abbreviation

Recombinant Human TXN protein

Gene Name

TXN

UniProt

P10599

Expression Region

2-105aa

Organism

Homo sapiens (Human)

Target Sequence

VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transport

Relevance

Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; FUNCTION

Molecular Weight

38.6 kDa

References & Citations

Cloning and expression of a cDNA for human thioredoxin.Wollman E.E., D'Auriol L., Rimsky L., Shaw A., Jacquot J.-P., Wingfield P., Graber P., Dessarps F.J. Biol. Chem. 263:15506-15512 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS801085 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
BAG1 (NM_004323) Human Over-expression Lysate
LC401375 20 µg

BAG1 (NM_004323) Human Over-expression Lysate

Sign In for Pricing
View Details
OR5A1 Antibody
8G909-AAT 50 µg

OR5A1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS507761 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Vmn1r64 Mouse Gene Knockout Kit (CRISPR)
KN519079 1 Kit

Vmn1r64 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mix-n-StainTM CF®450 Antibody Labeling Kit, 1x (50-100ug) labeling
#92324 1 Kit

Mix-n-StainTM CF®450 Antibody Labeling Kit, 1x (50-100ug) labeling

Sign In for Pricing
View Details