Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y, human, rat

Product Specifications

Synonyms

H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-N

Molecular Formula

C189H285N55O57S

Molecular Weight

4,271.7 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 810 Anti-human CD29 Antibody *HI29a*
102900O0-AAT 100 Tests

IFluor® 810 Anti-human CD29 Antibody *HI29a*

Sign In for Pricing
View Details
DNASE1 polyclonal antibody
orb648729-01 50 μL

DNASE1 polyclonal antibody

Sign In for Pricing
View Details
DNASE1 polyclonal antibody
orb648729-02 100 µL

DNASE1 polyclonal antibody

Sign In for Pricing
View Details
DNASE1 polyclonal antibody
orb648729-03 200 µL

DNASE1 polyclonal antibody

Sign In for Pricing
View Details
MAPKAPK2 Antibody - N-terminal region
MBS3219772-01 0.1 mL

MAPKAPK2 Antibody - N-terminal region

Sign In for Pricing
View Details
MAPKAPK2 Antibody - N-terminal region
MBS3219772-02 5x 0.1 mL

MAPKAPK2 Antibody - N-terminal region

Sign In for Pricing
View Details