Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y, human, rat

Product Specifications

Synonyms

H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-N

Molecular Formula

C189H285N55O57S

Molecular Weight

4,271.7 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat INSRR Protein, His (Fc)-Avi-tagged
INSRR-2738R 50 µg

Recombinant Rat INSRR Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Phospho-AMPK alpha 2 (Ser173) Rabbit Polyclonal Antibody (PE-Cy7)
orb895007 100 µL

Phospho-AMPK alpha 2 (Ser173) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Heat Shock Protein 104 Saccharomyces cerevisiae (Recombinant)
22061019-1 10 μg

Heat Shock Protein 104 Saccharomyces cerevisiae (Recombinant)

Sign In for Pricing
View Details
TMPase Rabbit Monoclonal Antibody
orb3072748-01 30 µL

TMPase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TMPase Rabbit Monoclonal Antibody
orb3072748-02 50 µL

TMPase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TMPase Rabbit Monoclonal Antibody
orb3072748-03 100 µL

TMPase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details