Neuropeptide Y, human, rat
Product Specifications
Synonyms
H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-N
Molecular Formula
C189H285N55O57S
Molecular Weight
4,271.7 g/mol
Controlled
No
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2163329-01 0.1 mL
APC_Cy7-Linked Polyclonal Antibody to Growth Differentiation Factor 15 (GDF15)
Sign In for Pricing
View Details MBS2163329-02 0.2 mL
APC_Cy7-Linked Polyclonal Antibody to Growth Differentiation Factor 15 (GDF15)
Sign In for Pricing
View Details MBS2163329-03 0.5 mL
APC_Cy7-Linked Polyclonal Antibody to Growth Differentiation Factor 15 (GDF15)
Sign In for Pricing
View Details MBS2163329-04 1 mL
APC_Cy7-Linked Polyclonal Antibody to Growth Differentiation Factor 15 (GDF15)
Sign In for Pricing
View Details MBS2163329-05 5 mL
APC_Cy7-Linked Polyclonal Antibody to Growth Differentiation Factor 15 (GDF15)
Sign In for Pricing
View Details