Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y, human, rat

Product Specifications

Synonyms

H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-N

Molecular Formula

C189H285N55O57S

Molecular Weight

4,271.7 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinol Binding Protein 4 (RBP4, PRBP, PRO2222) discontinued
R1701-35P 1 mg

Retinol Binding Protein 4 (RBP4, PRBP, PRO2222) discontinued

Sign In for Pricing
View Details
IQCJ Antibody
A45987-50UL 50 μL

IQCJ Antibody

Sign In for Pricing
View Details
SATB1 (NM_001131010) Human Recombinant Protein
TP326152 20 µg

SATB1 (NM_001131010) Human Recombinant Protein

Sign In for Pricing
View Details
AdmiRa-Off-mmu-miR-873b Virus
mm6935 1.0 mL

AdmiRa-Off-mmu-miR-873b Virus

Sign In for Pricing
View Details
Ccdc66 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4943502 1.0 µg DNA

Ccdc66 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
CEBPB discontinued
387369-01 20 µL

CEBPB discontinued

Sign In for Pricing
View Details