Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEAP-2 (38-77) (Human)

Product Specifications

Synonyms

H-MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVA

Molecular Formula

C191H320N64O57S5

Molecular Weight

4,585.36 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cucumis sativus Photosystem I reaction center subunit XI, chloroplastic (PSAL)
MBS7027084-01 0.02 mg

Recombinant Cucumis sativus Photosystem I reaction center subunit XI, chloroplastic (PSAL)

Sign In for Pricing
View Details
Recombinant Cucumis sativus Photosystem I reaction center subunit XI, chloroplastic (PSAL)
MBS7027084-02 0.1 mg

Recombinant Cucumis sativus Photosystem I reaction center subunit XI, chloroplastic (PSAL)

Sign In for Pricing
View Details
Recombinant Cucumis sativus Photosystem I reaction center subunit XI, chloroplastic (PSAL)
MBS7027084-03 5x 0.1 mg

Recombinant Cucumis sativus Photosystem I reaction center subunit XI, chloroplastic (PSAL)

Sign In for Pricing
View Details
Human ERCC3 Pre-designed siRNA Set B
SI005083B 1 Each

Human ERCC3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Solo/SESTD1 Antibody Picoband® Fluoro594 Conjugated
A10698-1-Fluoro594 100 µg/Vial

Anti-Solo/SESTD1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Anti-Human CXCL11/I-TAC Antibody (SAA0466), APC
FHA24613 100 Tests

Anti-Human CXCL11/I-TAC Antibody (SAA0466), APC

Sign In for Pricing
View Details