Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEAP-2 (38-77) (Human)

Product Specifications

Synonyms

H-MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVA

Molecular Formula

C191H320N64O57S5

Molecular Weight

4,585.36 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Human IgM (u chain), F(ab)'2 Fragment - Affinity Pure, TRITC Conjugate, min x w/human IgA + IgG
MBS686245-01 0.5 mg

Goat anti-Human IgM (u chain), F(ab)'2 Fragment - Affinity Pure, TRITC Conjugate, min x w/human IgA + IgG

Sign In for Pricing
View Details
Goat anti-Human IgM (u chain), F(ab)'2 Fragment - Affinity Pure, TRITC Conjugate, min x w/human IgA + IgG
MBS686245-02 5x 0.5 mg

Goat anti-Human IgM (u chain), F(ab)'2 Fragment - Affinity Pure, TRITC Conjugate, min x w/human IgA + IgG

Sign In for Pricing
View Details
FAM9C Antibody
orb1561314-01 50 µL

FAM9C Antibody

Sign In for Pricing
View Details
FAM9C Antibody
orb1561314-02 100 µL

FAM9C Antibody

Sign In for Pricing
View Details
FAM9C Antibody
orb1561314-03 200 µL

FAM9C Antibody

Sign In for Pricing
View Details
Rabbit anti-human MOB kinase activator 1A polyclonal Antibody
MBS7004144-01 0.05 mg

Rabbit anti-human MOB kinase activator 1A polyclonal Antibody

Sign In for Pricing
View Details