Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEAP-2 (38 - 77) (Human)

Product Specifications

Synonyms

H-MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE-OH

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-H4 Double Nickase Plasmid (m)
sc-433877-NIC 20 µg

B7-H4 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
MOPS Buffer 0.2M, pH 5.5
40120256-2 250 ml

MOPS Buffer 0.2M, pH 5.5

Sign In for Pricing
View Details
IL-5 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1318R-BF555-01 20 µL

IL-5 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
IL-5 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1318R-BF555-02 100 µL

IL-5 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
pDsRed1-N1-CLOCK Plasmid
PVT59475 2 µg

pDsRed1-N1-CLOCK Plasmid

Sign In for Pricing
View Details
Simian IGF1 (Insulin Like Growth Factor 1) ELISA Kit
orb3127079-01 48 Tests

Simian IGF1 (Insulin Like Growth Factor 1) ELISA Kit

Sign In for Pricing
View Details