Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEAP-2 (38 - 77) (Human)

Product Specifications

Synonyms

H-MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE-OH

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Small Ubiquitin Related Modifier Protein 1 (SUMO1) Antibody
abx129146-01 100 µL

Small Ubiquitin Related Modifier Protein 1 (SUMO1) Antibody

Sign In for Pricing
View Details
Small Ubiquitin Related Modifier Protein 1 (SUMO1) Antibody
abx129146-02 200 µL

Small Ubiquitin Related Modifier Protein 1 (SUMO1) Antibody

Sign In for Pricing
View Details
Small Ubiquitin Related Modifier Protein 1 (SUMO1) Antibody
abx129146-03 1 mL

Small Ubiquitin Related Modifier Protein 1 (SUMO1) Antibody

Sign In for Pricing
View Details
Human Tumor suppressor p53-binding protein 1, TP53BP1 ELISA KIT
E6352Hu-01 48 Well

Human Tumor suppressor p53-binding protein 1, TP53BP1 ELISA KIT

Sign In for Pricing
View Details
Human Tumor suppressor p53-binding protein 1, TP53BP1 ELISA KIT
E6352Hu-02 96 Well

Human Tumor suppressor p53-binding protein 1, TP53BP1 ELISA KIT

Sign In for Pricing
View Details
Human Tumor suppressor p53-binding protein 1, TP53BP1 ELISA KIT
E6352Hu-03 5x 96 Tests

Human Tumor suppressor p53-binding protein 1, TP53BP1 ELISA KIT

Sign In for Pricing
View Details