Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEAP-2 (38 - 77) (Human)

Product Specifications

Synonyms

H-MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE-OH

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HXA10 Polyclonal Antibody
ABP58832-01 30 µL

HXA10 Polyclonal Antibody

Sign In for Pricing
View Details
HXA10 Polyclonal Antibody
ABP58832-02 100 µL

HXA10 Polyclonal Antibody

Sign In for Pricing
View Details
HXA10 Polyclonal Antibody
ABP58832-03 200 µL

HXA10 Polyclonal Antibody

Sign In for Pricing
View Details
LBP Antibody
GWB-6342CC 0.05 mg

LBP Antibody

Sign In for Pricing
View Details
ZCCHC5 sgRNA CRISPR Lentivector (Human) (Target 1)
K2666402 1.0 µg DNA

ZCCHC5 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Endothelium (AP) discontinued
E2292-01R-AP 100 µL

Endothelium (AP) discontinued

Sign In for Pricing
View Details