Human Natriuretic peptides A (NPPA)
Product Specifications
Synonyms
H-PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL-OH
Controlled
No
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-62052R-Cy3-TR 20 µL
Apolipoprotein F Recombinant Antibody, Cy3 Conjugated
Sign In for Pricing
View Details 
bs-8499R-APC-Cy5.5 100 µL
RED Polyclonal Antibody, APC-Cy5.5 Conjugated
Sign In for Pricing
View Details ST61A0055_1T20C Box of 100
Box of 100 Discs of Standard Filter 73G/M², 55/20 Mm
Sign In for Pricing
View Details K0697108 1.0 µg DNA
ESR2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details