Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Natriuretic peptides A (NPPA)

Product Specifications

Synonyms

H-PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL-OH

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal GLG1 (Golgi Glycoprotein 1) (Marker for Human Cells) Antibody, Clone: GLG1/970
APR14649G 7 ml

Monoclonal GLG1 (Golgi Glycoprotein 1) (Marker for Human Cells) Antibody, Clone: GLG1/970

Sign In for Pricing
View Details
Bbs10 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6611902 1.0 µg DNA

Bbs10 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
KBP rabbit pAb
E44H15658 100 µL

KBP rabbit pAb

Sign In for Pricing
View Details
MMP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D9]
TA806873AM 100 µL

MMP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D9]

Sign In for Pricing
View Details
Ephb6, ID (Ephb6, Cekl, Ephrin type-B receptor 6, MEP, Tyrosine-protein kinase-defective receptor EPH-6) (FITC)
MBS6296066-01 0.2 mL

Ephb6, ID (Ephb6, Cekl, Ephrin type-B receptor 6, MEP, Tyrosine-protein kinase-defective receptor EPH-6) (FITC)

Sign In for Pricing
View Details
Ephb6, ID (Ephb6, Cekl, Ephrin type-B receptor 6, MEP, Tyrosine-protein kinase-defective receptor EPH-6) (FITC)
MBS6296066-02 5x 0.2 mL

Ephb6, ID (Ephb6, Cekl, Ephrin type-B receptor 6, MEP, Tyrosine-protein kinase-defective receptor EPH-6) (FITC)

Sign In for Pricing
View Details