Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Natriuretic peptides A (NPPA)

Product Specifications

Synonyms

H-PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL-OH

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCA2 (Calcium-activated Chloride Channel Regulator 2, Calcium-activated Chloride Channel Family Member 2, hCLCA2, Calcium-activated Chloride Channel Protein 3, CaCC-3, hCaCC-3, CACC3) (Biotin)
MBS6141227-01 0.1 mL

CLCA2 (Calcium-activated Chloride Channel Regulator 2, Calcium-activated Chloride Channel Family Member 2, hCLCA2, Calcium-activated Chloride Channel Protein 3, CaCC-3, hCaCC-3, CACC3) (Biotin)

Sign In for Pricing
View Details
CLCA2 (Calcium-activated Chloride Channel Regulator 2, Calcium-activated Chloride Channel Family Member 2, hCLCA2, Calcium-activated Chloride Channel Protein 3, CaCC-3, hCaCC-3, CACC3) (Biotin)
MBS6141227-02 5x 0.1 mL

CLCA2 (Calcium-activated Chloride Channel Regulator 2, Calcium-activated Chloride Channel Family Member 2, hCLCA2, Calcium-activated Chloride Channel Protein 3, CaCC-3, hCaCC-3, CACC3) (Biotin)

Sign In for Pricing
View Details
TAK1 Rabbit Polyclonal Antibody (PE-Cy7)
orb901741 100 µL

TAK1 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Myc tag Blocking Peptide
33R-11036 50 ug

Myc tag Blocking Peptide

Sign In for Pricing
View Details
Rabbit anti-Cathepsin S Antibody
DL97630A-01 50 µL

Rabbit anti-Cathepsin S Antibody

Sign In for Pricing
View Details
Rabbit anti-Cathepsin S Antibody
DL97630A-02 100 µL

Rabbit anti-Cathepsin S Antibody

Sign In for Pricing
View Details