Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Natriuretic peptides A (NPPA)

Product Specifications

Synonyms

H-PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL-OH

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCP5 protein (Mouse)
30R-AM066 20 ug

MCP5 protein (Mouse)

Sign In for Pricing
View Details
Non-Metastatic Cells 4 Human Recombinant (NME4 Human)
PT_72892-01 5 µg

Non-Metastatic Cells 4 Human Recombinant (NME4 Human)

Sign In for Pricing
View Details
Non-Metastatic Cells 4 Human Recombinant (NME4 Human)
PT_72892-02 20 µg

Non-Metastatic Cells 4 Human Recombinant (NME4 Human)

Sign In for Pricing
View Details
Non-Metastatic Cells 4 Human Recombinant (NME4 Human)
PT_72892-03 1 mg

Non-Metastatic Cells 4 Human Recombinant (NME4 Human)

Sign In for Pricing
View Details
3-Formyl-5- (trifluoromethyl) phenylboronic acid
PC1023092 1 Each

3-Formyl-5- (trifluoromethyl) phenylboronic acid

Sign In for Pricing
View Details
Human WWC3 Pre-designed siRNA Set A
SI018295A 1 Each

Human WWC3 Pre-designed siRNA Set A

Sign In for Pricing
View Details