H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
Product Specifications
Synonyms
H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Le u-Gly-Ser-Pro-Arg-Ser-acid; Endothelin 1 (Big) (1-39) (human)
Controlled
No
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2114060-01 0.1 mL
FITC-Linked Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
Sign In for Pricing
View Details MBS2114060-02 0.2 mL
FITC-Linked Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
Sign In for Pricing
View Details MBS2114060-03 0.5 mL
FITC-Linked Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
Sign In for Pricing
View Details MBS2114060-04 1 mL
FITC-Linked Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
Sign In for Pricing
View Details MBS2114060-05 5 mL
FITC-Linked Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
Sign In for Pricing
View Details MBS2114060-06 5x 5 mL
FITC-Linked Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
Sign In for Pricing
View Details