Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH

Product Specifications

Synonyms

H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Le u-Gly-Ser-Pro-Arg-Ser-acid; Endothelin 1 (Big) (1-39) (human)

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) - (+) -Diphenylphosphino-1,1'-binaphth-2-ol
sc-272178 50 mg

(R) - (+) -Diphenylphosphino-1,1'-binaphth-2-ol

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)
MBS1357651-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)
MBS1357651-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)
MBS1357651-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)
MBS1357651-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)
MBS1357651-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Myrosinase-binding protein-like At1g52040 (At1g52040)

Sign In for Pricing
View Details