Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (3-42), human

Product Specifications

Synonyms

H-EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNI

Molecular Formula

C214H324N58O63S

Molecular Weight

4,749.38 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENOS Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2436425 100 µL

ENOS Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Interleukin 5 Receptor Alpha (IL5Ra) Polyclonal Antibody
CAU25791-01 100 µL

Interleukin 5 Receptor Alpha (IL5Ra) Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 5 Receptor Alpha (IL5Ra) Polyclonal Antibody
CAU25791-02 200 µL

Interleukin 5 Receptor Alpha (IL5Ra) Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 5 Receptor Alpha (IL5Ra) Polyclonal Antibody
CAU25791-03 1 mL

Interleukin 5 Receptor Alpha (IL5Ra) Polyclonal Antibody

Sign In for Pricing
View Details
(S) -Boc-NH-Cy-C-NH2 (hydrochloride)
HY-W538924 1 Each

(S) -Boc-NH-Cy-C-NH2 (hydrochloride)

Sign In for Pricing
View Details
TRIB1, CT (Tribbles Homolog 1, TRB-1, SKIP1, G-protein-coupled Receptor-induced Protein 2, GIG-2, TRIB1, C8FW, GIG2) (PE)
MBS6503563-01 0.2 mL

TRIB1, CT (Tribbles Homolog 1, TRB-1, SKIP1, G-protein-coupled Receptor-induced Protein 2, GIG-2, TRIB1, C8FW, GIG2) (PE)

Sign In for Pricing
View Details