Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (3-42), human

Product Specifications

Synonyms

H-EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNI

Molecular Formula

C214H324N58O63S

Molecular Weight

4,749.38 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELF2-AS1 Human shRNA Plasmid Kit (Locus ID 414196)
TR314403 1 Kit

CELF2-AS1 Human shRNA Plasmid Kit (Locus ID 414196)

Sign In for Pricing
View Details
Brucine
TB0674-0100 4X20mg

Brucine

Sign In for Pricing
View Details
Pias1 3'UTR Lenti-reporter-Luc Vector
36632086 1.0 µg

Pias1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ASP6432 10mM * 1mL in DMSO
A18759-10mM-D 10 mM x 1mL in DMSO

ASP6432 10mM * 1mL in DMSO

Sign In for Pricing
View Details
ALS2CR8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0077807 1.0 µg DNA

ALS2CR8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Protein Kinase C and casein Kinase substrate in neurons protein 1 (PACSIN1) Rat ELISA Kit
G3470 96 Tests

Protein Kinase C and casein Kinase substrate in neurons protein 1 (PACSIN1) Rat ELISA Kit

Sign In for Pricing
View Details