Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Endothelin-3 (Human, 1-41 Amide) Acetate

Product Specifications

CAS Number

133551-97-0

Synonyms

[Cyc (1,15) (3,11) ]H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2

Molecular Formula

C223H322N56O63S4

Molecular Weight

4,923.65 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alpha 3 (ITGA3) (NM_002204) Human Over-expression Lysate
LY419471 100 µg

Integrin alpha 3 (ITGA3) (NM_002204) Human Over-expression Lysate

Sign In for Pricing
View Details
Canrenone-d6 (Major)
TRC-C175612-1MG 1 mg

Canrenone-d6 (Major)

Sign In for Pricing
View Details
AF067063 Mouse Gene Knockout Kit (CRISPR)
KN500948 1 Kit

AF067063 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TNFAIP8 Polyclonal Antibody
E-AB-17125-01 20 µL

TNFAIP8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFAIP8 Polyclonal Antibody
E-AB-17125-02 60 µL

TNFAIP8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFAIP8 Polyclonal Antibody
E-AB-17125-03 120 µL

TNFAIP8 Polyclonal Antibody

Sign In for Pricing
View Details