Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Endothelin-3 (Human, 1-41 Amide) Acetate

Product Specifications

CAS Number

133551-97-0

Synonyms

[Cyc (1,15) (3,11) ]H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2

Molecular Formula

C223H322N56O63S4

Molecular Weight

4,923.65 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SORCS1 Human Gene Knockout Kit (CRISPR)
KN419030 1 Kit

SORCS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAMK2N1 Human Gene Knockout Kit (CRISPR)
KN420095 1 Kit

CAMK2N1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dihydro Uracil-d4
TRC-D449993-1MG 1 mg

Dihydro Uracil-d4

Sign In for Pricing
View Details
Urb2 Mouse Gene Knockout Kit (CRISPR)
KN518748 1 Kit

Urb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Corrosion Tester BPTL-224
BPTL-224 1 Unit

Corrosion Tester BPTL-224

Sign In for Pricing
View Details
AP3M1 (NM_012095) Human Recombinant Protein
TP761671 50 µg

AP3M1 (NM_012095) Human Recombinant Protein

Sign In for Pricing
View Details