Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4

Product Specifications

CAS Number

141758-74-9

Synonyms

H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPP

Molecular Formula

C184H282N50O60S1

Molecular Weight

4,186.03 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRKD1 sgRNA gene knockout kit - Lentiviral human PRKD1 sgRNA gene knockout kit (plasmid)
GTR15356993 1 Vial

Lentiviral human PRKD1 sgRNA gene knockout kit - Lentiviral human PRKD1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
TLR7, CT (TLR7, Toll-like receptor 7) (AP) discontinued
042882-AP 200 µL

TLR7, CT (TLR7, Toll-like receptor 7) (AP) discontinued

Sign In for Pricing
View Details
RPL13A Rabbit Polyclonal Antibody (PE)
orb2608375 100 µg

RPL13A Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Rpp40 Mouse siRNA Oligo Duplex (Locus ID 208366)
SR408843 1 Kit

Rpp40 Mouse siRNA Oligo Duplex (Locus ID 208366)

Sign In for Pricing
View Details
C21orf90 CRISPR All-in-one AAV vector set (with saCas9)(Human)
14354151 3x 1.0 µg DNA

C21orf90 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human Cylindromatosis (CYLD) ELISA Kit
BSKH63372-01 48 Tests

Human Cylindromatosis (CYLD) ELISA Kit

Sign In for Pricing
View Details